PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 165aa    MW: 17960.3 Da    PI: 6.882
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101021.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.22.8e-20957149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k+i++ks+r++tf+kRr g++KKAeEL+ LC+  +avi fs+ g+++ +
  XP_011101021.1  9 KPIQDKSKRHTTFTKRRSGLFKKAEELCGLCGGAAAVITFSKAGNVFGF 57
                    68******************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-22160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-22174IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.077161IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-15323IPR002100Transcription factor, MADS-box
PfamPF003199.4E-191157IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MVRRRVEIKP IQDKSKRHTT FTKRRSGLFK KAEELCGLCG GAAAVITFSK AGNVFGFGHP  60
SVEHVVSRYL ADPNSTLVTE DEDSHVETCL HASGGGTEKK EVKAPPLTET ETRIAEALAN  120
HRPAWDVMVR NLALSELHEL EASVREIKST VEARAAEAEA EAAGI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101021.11e-118PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A022RM406e-42A0A022RM40_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-22AGAMOUS-like 61